Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF31 Rabbit Polyclonal Antibody (HRP)

ZNF31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KOX29, ZNF31, ZFP-31, ZNF360

UniProt

Q96FA9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEAS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

AAH11404

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiac Troponin T (TNNT2) (NM_001001430) Human Over-expression Lysate
LY424349 100 µg

Cardiac Troponin T (TNNT2) (NM_001001430) Human Over-expression Lysate

Sign In for Pricing
View Details
HBM (NM_001003938) Human Recombinant Protein
TP307833M 100 µg

HBM (NM_001003938) Human Recombinant Protein

Sign In for Pricing
View Details
BNIP3L Antibody (Biotin)
KB-7918-01 50 μL

BNIP3L Antibody (Biotin)

Sign In for Pricing
View Details
BNIP3L Antibody (Biotin)
KB-7918-02 100 µL

BNIP3L Antibody (Biotin)

Sign In for Pricing
View Details
BNIP3L Antibody (Biotin)
KB-7918-03 1 mL

BNIP3L Antibody (Biotin)

Sign In for Pricing
View Details
Pregnancy zone protein (PZP) (NM_002864) Human Over-expression Lysate
LY419057 100 µg

Pregnancy zone protein (PZP) (NM_002864) Human Over-expression Lysate

Sign In for Pricing
View Details