Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF342 Rabbit Polyclonal Antibody (HRP)

ZNF342 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFP296, ZNF342

UniProt

Q8WUU4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF342

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVVGPAAEAKSPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_660331

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM155A (N-term) Rabbit Polyclonal Antibody
AP51542PU-N 400 µL

FAM155A (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Peroxiredoxin 4 (Prognostic Marker for Lung SqCC) (CPTC-PRDX4-2), CF594 conjugate, 0.1mg/mL
BNC942483-500 1x 500 µL

Peroxiredoxin 4 (Prognostic Marker for Lung SqCC) (CPTC-PRDX4-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]
AM31226FC-N 1 mL (100 Tests)

CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]

Sign In for Pricing
View Details
Rabbit IgG (Fcγ Fragment specific), AlpHcAbs® Goat antibody
HA710048 100 µg

Rabbit IgG (Fcγ Fragment specific), AlpHcAbs® Goat antibody

Sign In for Pricing
View Details
Sodium 4-(2-Ethylhexyl) 2-Sulfobutanedioate
TRC-S625315-50MG 50 mg

Sodium 4-(2-Ethylhexyl) 2-Sulfobutanedioate

Sign In for Pricing
View Details
(S,R)-N-(1-Phenylethyl) Ibuprofen Amide
TRC-P320895-5MG 5 mg

(S,R)-N-(1-Phenylethyl) Ibuprofen Amide

Sign In for Pricing
View Details