Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF485 Rabbit Polyclonal Antibody (HRP)

ZNF485 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NCK3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF485

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RHSSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHNKERAMKCS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANO2 (Anoctamin-2, Transmembrane Protein 16B, C12orf3, TMEM16B) (AP)
MBS6406509-01 0.1 mL

ANO2 (Anoctamin-2, Transmembrane Protein 16B, C12orf3, TMEM16B) (AP)

Sign In for Pricing
View Details
ANO2 (Anoctamin-2, Transmembrane Protein 16B, C12orf3, TMEM16B) (AP)
MBS6406509-02 5x 0.1 mL

ANO2 (Anoctamin-2, Transmembrane Protein 16B, C12orf3, TMEM16B) (AP)

Sign In for Pricing
View Details
Tert-Hexadecyl mercaptan Tech. Grade
H03300 25 mL

Tert-Hexadecyl mercaptan Tech. Grade

Sign In for Pricing
View Details
Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit
MBS7239840-01 48 Well

Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit

Sign In for Pricing
View Details
Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit
MBS7239840-02 96 Well

Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit

Sign In for Pricing
View Details
Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit
MBS7239840-03 5x 96 Well

Rat Abhydrolase domain-containing protein 10, mitochondrial (ABHD10) ELISA Kit

Sign In for Pricing
View Details