Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF485 Rabbit Polyclonal Antibody (HRP)

ZNF485 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NCK3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF485

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RHSSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHNKERAMKCS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gapdhs (NM_008085) Mouse Tagged ORF Clone
MR220603 10 µg

Gapdhs (NM_008085) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ROCK2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
40677156 3x 1.0 µg DNA

ROCK2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
EN1 mouse monoclonal antibody, clone 1F5, Purified
AM31049PU-N 50 µg

EN1 mouse monoclonal antibody, clone 1F5, Purified

Sign In for Pricing
View Details
NANOG (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (MaxLight 405)
MBS6188614-01 0.1 mL

NANOG (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (MaxLight 405)

Sign In for Pricing
View Details
NANOG (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (MaxLight 405)
MBS6188614-02 5x 0.1 mL

NANOG (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (MaxLight 405)

Sign In for Pricing
View Details
SENP8 antibody
70R-51169 100 ul

SENP8 antibody

Sign In for Pricing
View Details