Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISL2 Rabbit Polyclonal Antibody (HRP)

ISL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ10160

UniProt

Q96A47

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ISL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_665804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Poly [ADP-ribose] polymerase 2, PARP2 ELISA KIT
E6741Hu-01 48 Well

Human Poly [ADP-ribose] polymerase 2, PARP2 ELISA KIT

Sign In for Pricing
View Details
Human Poly [ADP-ribose] polymerase 2, PARP2 ELISA KIT
E6741Hu-02 96 Well

Human Poly [ADP-ribose] polymerase 2, PARP2 ELISA KIT

Sign In for Pricing
View Details
Human Poly [ADP-ribose] polymerase 2, PARP2 ELISA KIT
E6741Hu-03 5x 96 Tests

Human Poly [ADP-ribose] polymerase 2, PARP2 ELISA KIT

Sign In for Pricing
View Details
Human Poly [ADP-ribose] polymerase 2, PARP2 ELISA KIT
E6741Hu-04 10x 96 Tests

Human Poly [ADP-ribose] polymerase 2, PARP2 ELISA KIT

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) NSP5 Recombinant Protein
20-215 0.1 mg

SARS-CoV-2 (COVID-19) NSP5 Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal Galectin-3BP/MAC-2BP/LGALS3BP Antibody [DyLight 594]
NBP2-97200DL594 0.1 mL

Rabbit Polyclonal Galectin-3BP/MAC-2BP/LGALS3BP Antibody [DyLight 594]

Sign In for Pricing
View Details