Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN21 Rabbit Polyclonal Antibody (Biotin)

ZSCAN21 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF38, Zipro1, NY-REN-21

UniProt

Q9Y5A6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZSCAN21

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_666019

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNA5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV673839 1.0 µg DNA

KCNA5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
DNAJB3 Protein Vector (Rat) (pPB-N-His)
PV264411 500 ng

DNAJB3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
C2orf27A Protein Vector (Human) (pPB-C-His)
PV066481 500 ng

C2orf27A Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human 5HT1D full length protein-synthetic nanodisc
MBS189914-01 0.01 mg

Human 5HT1D full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human 5HT1D full length protein-synthetic nanodisc
MBS189914-02 0.05 mg

Human 5HT1D full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human 5HT1D full length protein-synthetic nanodisc
MBS189914-03 0.1 mg

Human 5HT1D full length protein-synthetic nanodisc

Sign In for Pricing
View Details