Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN21 Rabbit Polyclonal Antibody (Biotin)

ZSCAN21 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF38, Zipro1, NY-REN-21

UniProt

Q9Y5A6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZSCAN21

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_666019

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Potassium Voltage-gated Channel Subfamily E Regulatory Subunit 5 ELISA Kit
MBS1603417-01 48 Well

Canine Potassium Voltage-gated Channel Subfamily E Regulatory Subunit 5 ELISA Kit

Sign In for Pricing
View Details
Canine Potassium Voltage-gated Channel Subfamily E Regulatory Subunit 5 ELISA Kit
MBS1603417-02 96 Well

Canine Potassium Voltage-gated Channel Subfamily E Regulatory Subunit 5 ELISA Kit

Sign In for Pricing
View Details
Canine Potassium Voltage-gated Channel Subfamily E Regulatory Subunit 5 ELISA Kit
MBS1603417-03 5x 96 Well

Canine Potassium Voltage-gated Channel Subfamily E Regulatory Subunit 5 ELISA Kit

Sign In for Pricing
View Details
Canine Potassium Voltage-gated Channel Subfamily E Regulatory Subunit 5 ELISA Kit
MBS1603417-04 10x 96 Well

Canine Potassium Voltage-gated Channel Subfamily E Regulatory Subunit 5 ELISA Kit

Sign In for Pricing
View Details
Pfn2 siRNA Oligos set (Mouse)
36451174 3x 5 nmol

Pfn2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
4-Methyl-1-octanol
433069-01 25 mg

4-Methyl-1-octanol

Sign In for Pricing
View Details