Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmbx1 Rabbit Polyclonal Antibody (Biotin)

Dmbx1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

At, Atx, Mbx, Otx, Cdmx, Otx3

UniProt

Q91ZK4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dmbx1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLSAAAAAHQGVWGSPLLPAPPTGLAPASAALNSKTTSIENLRLRAKQHA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_570935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tonsil Tissue Slides (Lymphoma)
NBP2-77940 5 Slides

Tonsil Tissue Slides (Lymphoma)

Sign In for Pricing
View Details
Guinea pig Beta-Defensin 14 ELISA Kit
MBS755664-01 48 Well

Guinea pig Beta-Defensin 14 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Beta-Defensin 14 ELISA Kit
MBS755664-02 96 Well

Guinea pig Beta-Defensin 14 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Beta-Defensin 14 ELISA Kit
MBS755664-03 5x 96 Well

Guinea pig Beta-Defensin 14 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Beta-Defensin 14 ELISA Kit
MBS755664-04 10x 96 Well

Guinea pig Beta-Defensin 14 ELISA Kit

Sign In for Pricing
View Details
Anti-GDF15 Antibody Picoband® Fluoro594 Conjugated
A01583-1-Fluoro594 100 µg/Vial

Anti-GDF15 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details