Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIC Rabbit Polyclonal Antibody (Biotin)

SPIC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SPI-C

UniProt

Q8N5J4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SPIC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGNS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit
MBS457425-01 48 Tests

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit

Sign In for Pricing
View Details
Human Adenosine A2a Receptor (ADORA2a) ELISA Kit
MBS457425-02 96 Tests

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit

Sign In for Pricing
View Details
Human Adenosine A2a Receptor (ADORA2a) ELISA Kit
MBS457425-03 5x 96 Tests

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit

Sign In for Pricing
View Details
Human Adenosine A2a Receptor (ADORA2a) ELISA Kit
MBS457425-04 10x 96 Tests

Human Adenosine A2a Receptor (ADORA2a) ELISA Kit

Sign In for Pricing
View Details
NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 6 (LYR Motif-Containing Protein 6, NADH-Ubiquinone Oxidoreductase B14 Subunit, NDUFA6, LYRM6, NADHB14) (Biotin)
227831 100 µg

NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 6 (LYR Motif-Containing Protein 6, NADH-Ubiquinone Oxidoreductase B14 Subunit, NDUFA6, LYRM6, NADHB14) (Biotin)

Sign In for Pricing
View Details
HMGN3, NT (HMGN3, TRIP7, High mobility group nucleosome-binding domain-containing protein 3, Thyroid receptor-interacting protein 7) (APC) discontinued
036646-APC 200 µL

HMGN3, NT (HMGN3, TRIP7, High mobility group nucleosome-binding domain-containing protein 3, Thyroid receptor-interacting protein 7) (APC) discontinued

Sign In for Pricing
View Details