Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIC Rabbit Polyclonal Antibody (HRP)

SPIC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPI-C

UniProt

Q8N5J4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPIC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQRLSPSYFLGKEIFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_689536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC57 Protein Vector (Mouse) (pPB-N-His)
PV197767 500 ng

LRRC57 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
MRX28 siRNA Oligos set (Human)
30652171 3x 5 nmol

MRX28 siRNA Oligos set (Human)

Sign In for Pricing
View Details
CCDC91, CT (CCDC91, GGABP, Coiled-coil domain-containing protein 91, GGA-binding partner, p56 accessory protein) (Azide free) (HRP)
MBS6281952-01 0.2 mL

CCDC91, CT (CCDC91, GGABP, Coiled-coil domain-containing protein 91, GGA-binding partner, p56 accessory protein) (Azide free) (HRP)

Sign In for Pricing
View Details
CCDC91, CT (CCDC91, GGABP, Coiled-coil domain-containing protein 91, GGA-binding partner, p56 accessory protein) (Azide free) (HRP)
MBS6281952-02 5x 0.2 mL

CCDC91, CT (CCDC91, GGABP, Coiled-coil domain-containing protein 91, GGA-binding partner, p56 accessory protein) (Azide free) (HRP)

Sign In for Pricing
View Details
Human FN Protein, His Tag
KMPH1447 100 µg

Human FN Protein, His Tag

Sign In for Pricing
View Details
Mouse Monoclonal HO-2/HMOX2 Antibody (OTI1C2) [PE]
NBP2-70895PE 0.1 mL

Mouse Monoclonal HO-2/HMOX2 Antibody (OTI1C2) [PE]

Sign In for Pricing
View Details