Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF440 Rabbit Polyclonal Antibody (HRP)

ZNF440 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IYI8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF440

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VNFTQEEWALLDISQRKLYREVMLETFRNLTSLGKRWKDQNIEYEHQNPR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689570

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human JPT1 activation kit by CRISPRa
GA109611 1 Kit

Human JPT1 activation kit by CRISPRa

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF640R conjugate, 0.1mg/mL
BNC402153-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF647 conjugate, 0.1mg/mL
BNC473066-500 1x 500 µL

HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APPBP1 (NAE1) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF804283 100 µg

APPBP1 (NAE1) Mouse Monoclonal Antibody [Clone ID: OTI1B2]

Sign In for Pricing
View Details
Twinkle (TWNK) Human Gene Knockout Kit (CRISPR)
KN417014 1 Kit

Twinkle (TWNK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EWSR1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B3]
TA813053BM 100 µL

EWSR1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B3]

Sign In for Pricing
View Details