Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kbtbd5 Rabbit Polyclonal Antibody (FITC)

Kbtbd5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Kbtbd5, 2310024D23Rik

UniProt

Q9D783

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRVGEREFPCHRLVLA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082478

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR56A5 Human Gene Knockout Kit (CRISPR)
KN428246 1 Kit

OR56A5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rep15 Mouse Gene Knockout Kit (CRISPR)
KN514666 1 Kit

Rep15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Prolactin (PRL) ELISA Kit
RD-PRL-Rb-01 96 Tests

Rabbit Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
Rabbit Prolactin (PRL) ELISA Kit
RD-PRL-Rb-02 48 Tests

Rabbit Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
Human MACO1 activation kit by CRISPRa
GA110617 1 Kit

Human MACO1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mini Sample Mouse CLU (Clusterin) ELISA Kit
E-MSEL-M0063-01 24 Tests

Mini Sample Mouse CLU (Clusterin) ELISA Kit

Sign In for Pricing
View Details