Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF786 Rabbit Polyclonal Antibody (Biotin)

ZNF786 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8N393

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF786

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAEPPRLPLTFEDVAIYFSEQEWQDLEAWQKELYKHVMRSNYETLVSLDD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

EAW80063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Car9 Protein, His-tagged, Alexa Fluor 488 conjugated
Car9-914MAF488 20 μg- 50 μg- 100 μg

Recombinant Mouse Car9 Protein, His-tagged, Alexa Fluor 488 conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal IRF1 Antibody [Alexa Fluor 350]
NBP1-78763AF350 0.1 mL

Rabbit Polyclonal IRF1 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (PE)
MBS6187894-01 0.1 mL

PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (PE)

Sign In for Pricing
View Details
PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (PE)
MBS6187894-02 5x 0.1 mL

PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (PE)

Sign In for Pricing
View Details
CASP6 Rabbit Monoclonal Antibody [Clone ID: 23GB5635]
TA424593 100 µL

CASP6 Rabbit Monoclonal Antibody [Clone ID: 23GB5635]

Sign In for Pricing
View Details
Stard3 (NM_001014229) Rat Tagged Lenti ORF Clone
RR205175L4 10 µg

Stard3 (NM_001014229) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details