Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN29 Rabbit Polyclonal Antibody (FITC)

ZSCAN29 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KSALRENGTNSETFRQRFRRFHYQEVAGPREAFSQLWELCCRWLRPEVRT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KSALRENGTNSETFRQRFRRFHYQEVAGPREAFSQLWELCCRWLRPEVRT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_689668

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM75E2P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20128061 1.0 µg DNA

FAM75E2P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SHH (Sonic Hedgehog Protein, HHG-1, Sonic Hedgehog Protein N-product, Sonic Hedgehog Protein C-product) (MaxLight 405) discontinued
133323-ML405 100 µL

SHH (Sonic Hedgehog Protein, HHG-1, Sonic Hedgehog Protein N-product, Sonic Hedgehog Protein C-product) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Cyclin G Polyclonal Antibody, PerCP Conjugated
bs-25631R-PerCP 100 µL

Cyclin G Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Myosin Ib CRISPR Activation Plasmid (m)
sc-421795-ACT 20 µg

Myosin Ib CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
C21orf59 antibody
MBS831094-01 0.1 mL

C21orf59 antibody

Sign In for Pricing
View Details
C21orf59 antibody
MBS831094-02 5x 0.1 mL

C21orf59 antibody

Sign In for Pricing
View Details