Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN29 Rabbit Polyclonal Antibody (HRP)

ZSCAN29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KSALRENGTNSETFRQRFRRFHYQEVAGPREAFSQLWELCCRWLRPEVRT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSALRENGTNSETFRQRFRRFHYQEVAGPREAFSQLWELCCRWLRPEVRT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_689668

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen III alpha 1/COL3A1 Rabbit mAb (AMR12858N)
AMR12858N-01 50 µL

Collagen III alpha 1/COL3A1 Rabbit mAb (AMR12858N)

Sign In for Pricing
View Details
Collagen III alpha 1/COL3A1 Rabbit mAb (AMR12858N)
AMR12858N-02 100 µL

Collagen III alpha 1/COL3A1 Rabbit mAb (AMR12858N)

Sign In for Pricing
View Details
Collagen III alpha 1/COL3A1 Rabbit mAb (AMR12858N)
AMR12858N-03 200 µL

Collagen III alpha 1/COL3A1 Rabbit mAb (AMR12858N)

Sign In for Pricing
View Details
APOOL antibody
70R-36718 100 ug

APOOL antibody

Sign In for Pricing
View Details
PRAME (NM_206955) Human Over-expression Lysate
LH16696V 100 µg

PRAME (NM_206955) Human Over-expression Lysate

Sign In for Pricing
View Details
Tdrd1 Rat shRNA Lentiviral Particle (Locus ID 292129)
TL704789V 500 µL Each

Tdrd1 Rat shRNA Lentiviral Particle (Locus ID 292129)

Sign In for Pricing
View Details