Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN29 Rabbit Polyclonal Antibody (HRP)

ZSCAN29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZSCAN29

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSDLRAHHRTHTGEKPYGCHDCGKCFSKSSALNKHGEIHAREKLLTQSAP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Opioid Receptor (Ab 375) Antibody
79-615 0.1 mg

Opioid Receptor (Ab 375) Antibody

Sign In for Pricing
View Details
group II sPLA2 CRISPR/Cas9 KO Plasmid (m)
sc-422281 20 µg

group II sPLA2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
CYP3A4 siRNA (Human)
CRH1106-01 15 nmol

CYP3A4 siRNA (Human)

Sign In for Pricing
View Details
CYP3A4 siRNA (Human)
CRH1106-02 30 nmol

CYP3A4 siRNA (Human)

Sign In for Pricing
View Details
Gfra2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6852602 1.0 µg DNA

Gfra2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human RNF43, His Tag
E24PHC961 50 µg

Human RNF43, His Tag

Sign In for Pricing
View Details