Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF597 Rabbit Polyclonal Antibody (HRP)

ZNF597 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HIT-4

UniProt

Q96LX8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF597

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CEESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHIKNT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific,  40nm
GAF-451-40 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific, 40nm

Sign In for Pricing
View Details
PKC alpha Recombinant Rabbit Monoclonal Antibody [SU31-08]
ET1608-15 100 µL

PKC alpha Recombinant Rabbit Monoclonal Antibody [SU31-08]

Sign In for Pricing
View Details
CDCP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B8]
TA502171BM 100 µL

CDCP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B8]

Sign In for Pricing
View Details
Human Matrilin 2 (MATN2) activation kit by CRISPRa
GA102825 1 Kit

Human Matrilin 2 (MATN2) activation kit by CRISPRa

Sign In for Pricing
View Details
Human C1orf170 (PERM1) activation kit by CRISPRa
GA113700 1 Kit

Human C1orf170 (PERM1) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Slx1b activation kit by CRISPRa
GA210339 1 Kit

Mouse Slx1b activation kit by CRISPRa

Sign In for Pricing
View Details