Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp74 Rabbit Polyclonal Antibody (HRP)

Zfp74 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KRA, Zfp6, KRAB8, Zfp66, Znf569, mszf21, mszf77, zfp-74, 2810054M15Rik

UniProt

Q80W31

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zfp74

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SNCGKAFSQISSLTLHMRKHTGEKPYVCIECGKAFSQKSHLVRHQRIHTH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848471

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HACE1 Mouse Monoclonal Antibody [Clone ID: OTI4F10]
CF810063 100 µg

HACE1 Mouse Monoclonal Antibody [Clone ID: OTI4F10]

Sign In for Pricing
View Details
TID1 (DNAJA3) (N-term) Rabbit Polyclonal Antibody
AP51285PU-N 400 µL

TID1 (DNAJA3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fatty Acid Synthase Rabbit Polyclonal Antibody
R1706-8 100 µL

Fatty Acid Synthase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CFAP97D1 Human Gene Knockout Kit (CRISPR)
KN427178 1 Kit

CFAP97D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kallikrein 12 (KLK12) activation kit by CRISPRa
GA109407 1 Kit

Human Kallikrein 12 (KLK12) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: left
CP565390 150 µg

Tissue Protein Lysate, Ovary: left

Sign In for Pricing
View Details