Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp759 Rabbit Polyclonal Antibody (Biotin)

Zfp759 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Rsl, Rslcan8, BC028265, Rslcan-8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGPPQWKLYRDVMLENYNNLVFLGLASSKPYLVRFLEQIQEPLDVKSQVA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EDL10320

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome C (Mitochondrial Marker) (7H8.2C12), Biotin conjugate, 0.1mg/mL
BNCB0183-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TUBAL3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]
TA503939BM 100 µL

TUBAL3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]

Sign In for Pricing
View Details
Horseradish Peroxidase / HRP Mouse Monoclonal Antibody [Clone ID: 3A5C6]
AM06196SU-N 100 µL

Horseradish Peroxidase / HRP Mouse Monoclonal Antibody [Clone ID: 3A5C6]

Sign In for Pricing
View Details
MTHFD1L Human Gene Knockout Kit (CRISPR)
KN423034 1 Kit

MTHFD1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDT2 (DTL) (NM_001286229) Human Tagged ORF Clone
RG238348 10 µg

CDT2 (DTL) (NM_001286229) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700761 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details