Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp759 Rabbit Polyclonal Antibody (HRP)

Zfp759 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rsl, Rslcan8, BC028265, Rslcan-8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGPPQWKLYRDVMLENYNNLVFLGLASSKPYLVRFLEQIQEPLDVKSQVA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EDL10320

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD247 (NM_198053) Human Recombinant Protein
TP314725M 100 µg

CD247 (NM_198053) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702033 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G7]
TA806009AM 100 µL

Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G7]

Sign In for Pricing
View Details
Glycyrrhizic Acid
TRC-G735150-10MG 10 mg

Glycyrrhizic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS804170 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
TOR4A Recombinant Rabbit Monoclonal Antibody [JE64-50]
HA722363 100 µL

TOR4A Recombinant Rabbit Monoclonal Antibody [JE64-50]

Sign In for Pricing
View Details