Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIER3 Rabbit Polyclonal Antibody (Biotin)

MIER3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZP781I1119, DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954

UniProt

Q7Z3K6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MIER3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_689835

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ß-Synuclein (Ab-129)
orb1139730 100 µL

Anti-ß-Synuclein (Ab-129)

Sign In for Pricing
View Details
CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) APC
MBS6374611-01 0.1 mL

CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) APC

Sign In for Pricing
View Details
CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) APC
MBS6374611-02 5x 0.1 mL

CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) APC

Sign In for Pricing
View Details
MMUT Rabbit Polyclonal Antibody
orb629054-01 50 µg

MMUT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMUT Rabbit Polyclonal Antibody
orb629054-02 100 µg

MMUT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR44 Protein Vector (Human) (pPM-C-HA)
PV046195 500 ng

WDR44 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details