Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIER3 Rabbit Polyclonal Antibody (FITC)

MIER3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZP781I1119, DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954

UniProt

Q7Z3K6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MIER3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_689835

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microscope Cover Slips No. 1.5 16mm
MIC2182 100 / PCK

Microscope Cover Slips No. 1.5 16mm

Sign In for Pricing
View Details
Slide-Stem Structure-Dicot Ligustrum, Ts Stem
4041400/19C 1 Each

Slide-Stem Structure-Dicot Ligustrum, Ts Stem

Sign In for Pricing
View Details
SFRP3 (Secreted Frizzled Related Protein 3, FRZB, FRE, OS1, FZRB, hFIZ, FRITZ, FRP-3, FRZB1, SRFP3, FRZB-1, FRZB-PEN) discontinued
219226-01 20 µL

SFRP3 (Secreted Frizzled Related Protein 3, FRZB, FRE, OS1, FZRB, hFIZ, FRITZ, FRP-3, FRZB1, SRFP3, FRZB-1, FRZB-PEN) discontinued

Sign In for Pricing
View Details
SFRP3 (Secreted Frizzled Related Protein 3, FRZB, FRE, OS1, FZRB, hFIZ, FRITZ, FRP-3, FRZB1, SRFP3, FRZB-1, FRZB-PEN) discontinued
219226-02 100 µL

SFRP3 (Secreted Frizzled Related Protein 3, FRZB, FRE, OS1, FZRB, hFIZ, FRITZ, FRP-3, FRZB1, SRFP3, FRZB-1, FRZB-PEN) discontinued

Sign In for Pricing
View Details
TTC10 (IFT88) (NM_006531) Human Over-expression Lysate
LS008100-100ug 100 µg

TTC10 (IFT88) (NM_006531) Human Over-expression Lysate

Sign In for Pricing
View Details
Caspase-1 Rabbit pAb
APA4824-01 30 µL

Caspase-1 Rabbit pAb

Sign In for Pricing
View Details