Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIER3 Rabbit Polyclonal Antibody (HRP)

MIER3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZP781I1119, DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954

UniProt

Q7Z3K6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MIER3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_689835

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPHL1 3'UTR GFP Stable Cell Line
TU065869 1.0 mL

NPHL1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)
MBS1222559-01 0.02 mg (E-Coli)

Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)
MBS1222559-02 0.1 mg (E-Coli)

Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)
MBS1222559-03 0.02 mg (Yeast)

Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)
MBS1222559-04 0.1 mg (Yeast)

Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)

Sign In for Pricing
View Details
Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)
MBS1222559-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium leprae Single-stranded DNA-binding protein (ssb)

Sign In for Pricing
View Details