Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPAS3 Rabbit Polyclonal Antibody (FITC)

NPAS3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MOP6, PASD6, bHLHe12

UniProt

Q8IXF0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NPAS3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001158221.1, NP_001158221

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psd sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37898114 3x 1.0 µg

Psd sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TRP12/TRPV4 Polyclonal Antibody, Cy7 Conjugated
bs-6425R-Cy7-01 20 µL

TRP12/TRPV4 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
TRP12/TRPV4 Polyclonal Antibody, Cy7 Conjugated
bs-6425R-Cy7-02 100 µL

TRP12/TRPV4 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
MOG Polyclonal Antibody, APC Conjugated
bs-0426R-APC 100 µL

MOG Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Torin 2
S2817-10mg 10 mg

Torin 2

Sign In for Pricing
View Details
Myozenin 1 (MYOZ1) (NM_021245) Human Recombinant Protein
E45H30938E1 50 µg

Myozenin 1 (MYOZ1) (NM_021245) Human Recombinant Protein

Sign In for Pricing
View Details