Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPAS3 Rabbit Polyclonal Antibody (HRP)

NPAS3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MOP6, PASD6, bHLHe12

UniProt

Q8IXF0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NPAS3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001158221.1, NP_001158221

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GADD45A (NM_001924) Human Recombinant Protein
TP720561L 500 µg

GADD45A (NM_001924) Human Recombinant Protein

Sign In for Pricing
View Details
(2R,3S)-2-Ethyl-1,3-hexanediol
TRC-E192790-100MG 100 mg

(2R,3S)-2-Ethyl-1,3-hexanediol

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701751 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
5mL MacroTube® Rack
C2590 1 Each

5mL MacroTube® Rack

Sign In for Pricing
View Details
MRP3 (Multidrug Resistance-Associated Protein 3) (ABCC3/2971), CF568 conjugate, 0.1mg/mL
BNC682971-500 1x 500 µL

MRP3 (Multidrug Resistance-Associated Protein 3) (ABCC3/2971), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Interleukin-17D/IL-17D Protein
PKSH033627-01 20 µg

Recombinant Human Interleukin-17D/IL-17D Protein

Sign In for Pricing
View Details