Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF772 Rabbit Polyclonal Antibody (HRP)

ZNF772 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q68DY9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF772

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DVFVYFSQEEWVLLDEAQRLLYRDVMLENFALMASLGHTSFMSHIVASLV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CALB2 Antibody
RC-4142-01 50 μL

Recombinant CALB2 Antibody

Sign In for Pricing
View Details
Recombinant CALB2 Antibody
RC-4142-02 100 µL

Recombinant CALB2 Antibody

Sign In for Pricing
View Details
Recombinant CALB2 Antibody
RC-4142-03 1 mL

Recombinant CALB2 Antibody

Sign In for Pricing
View Details
RASSF8 Rabbit Polyclonal Antibody
TA385135 100 µL

RASSF8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), CF640R conjugate, 0.1mg/mL
BNC400383-100 1x 100 µL

Cytokeratin 8 (K8/383), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RRP12 (NM_015179) Human Recombinant Protein
TP303502 20 µg

RRP12 (NM_015179) Human Recombinant Protein

Sign In for Pricing
View Details