Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF488 Rabbit Polyclonal Antibody (Biotin)

ZNF488 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96MN9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF488

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VFHMRSHHKKEHAGPDPHSQKRREEALACPVCQEHFRERHHLSRHMTSHS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694579

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal TNF RII/TNFRSF1B Antibody (R00N6)
NBP2-89487-500ug 500 µg

Rabbit Monoclonal TNF RII/TNFRSF1B Antibody (R00N6)

Sign In for Pricing
View Details
Lrit2-set siRNA/shRNA/RNAi Lentivector (Mouse)
27599094 4x 500 ng

Lrit2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
RPL34 Adenovirus (Human)
41448051 1.0 mL

RPL34 Adenovirus (Human)

Sign In for Pricing
View Details
GENLISA Canine Platelet-Derived Growth Factor Ab (PDGF-AB) ELISA
KLN0812 1x 96 Well

GENLISA Canine Platelet-Derived Growth Factor Ab (PDGF-AB) ELISA

Sign In for Pricing
View Details
Ap2m1 Rat shRNA Plasmid (Locus ID 116563)
TR712191 1 Kit

Ap2m1 Rat shRNA Plasmid (Locus ID 116563)

Sign In for Pricing
View Details
Rabbit Anti-Human Olfactory receptor 8G5 Polyclonal Antibody
PA87650HU-01 50 µg

Rabbit Anti-Human Olfactory receptor 8G5 Polyclonal Antibody

Sign In for Pricing
View Details