Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF488 Rabbit Polyclonal Antibody (FITC)

ZNF488 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q96MN9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF488

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VFHMRSHHKKEHAGPDPHSQKRREEALACPVCQEHFRERHHLSRHMTSHS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694579

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP12 Protein Vector (Human) (pPM-N-D-C-His)
PV320905 500 ng

AKAP12 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Zfpm1 (NM_009569) Mouse Tagged Lenti ORF Clone
MR225580L3 10 µg

Zfpm1 (NM_009569) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPS3A (NM_001006) Human Tagged ORF Clone Lentiviral Particle
RC201213L4V 200 µL

RPS3A (NM_001006) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Parasteatoda tepidariorim Wnt8 Rabbit Polyclonal Antibody (FITC)
orb2571390 200 µL

Parasteatoda tepidariorim Wnt8 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
anti- FOXD4 antibody
FNab03192 100 µg

anti- FOXD4 antibody

Sign In for Pricing
View Details
CSNK1A1, CT (Casein Kinase I Isoform alpha, CKI-alpha, CK1) (APC)
MBS6467340-01 0.2 mL

CSNK1A1, CT (Casein Kinase I Isoform alpha, CKI-alpha, CK1) (APC)

Sign In for Pricing
View Details