Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aebp2 Rabbit Polyclonal Antibody (Biotin)

Aebp2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AU023766, B230313N05Rik

UniProt

Q91YQ3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663448

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL6 Protein Lysate (Human) with C-Ha Tag
31251033 100 µg

MYL6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MIR4696 Human qPCR Template Standard (MI0017329)
HK301088 200 Reactions

MIR4696 Human qPCR Template Standard (MI0017329)

Sign In for Pricing
View Details
ABL2 Protein Vector (Rat) (pPM-C-HA)
PV251604 500 ng

ABL2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Anti-phospho-MCAM (Tyr641) antibody
SL5472R-01 50 µL

Rabbit Anti-phospho-MCAM (Tyr641) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-MCAM (Tyr641) antibody
SL5472R-02 100 µL

Rabbit Anti-phospho-MCAM (Tyr641) antibody

Sign In for Pricing
View Details
TWEAK (TNF-related Weak Inducer of Apoptosis, APO3 Ligand, APO3/DR3 Ligand, APO3L, CD255, DR3LG, FN14, HCG1991317, MGC129581, MGC20669, Tumor Necrosis Factor Ligand Superfamily Member 12, TNFSF12, UNQ181/PRO207) (MaxLight 750)
MBS6504225-01 0.1 mL

TWEAK (TNF-related Weak Inducer of Apoptosis, APO3 Ligand, APO3/DR3 Ligand, APO3L, CD255, DR3LG, FN14, HCG1991317, MGC129581, MGC20669, Tumor Necrosis Factor Ligand Superfamily Member 12, TNFSF12, UNQ181/PRO207) (MaxLight 750)

Sign In for Pricing
View Details