Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aebp2 Rabbit Polyclonal Antibody (FITC)

Aebp2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AU023766, B230313N05Rik

UniProt

Q91YQ3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663448

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOS2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61362R-BF555-TR 20 µL

NOS2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
DDX17 Rabbit Polyclonal Antibody (Cy5)
orb940773 100 µL

DDX17 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Rat anti aldolase (ALD) autoantibody ELISA kit
GTR10433441 96 Well

Rat anti aldolase (ALD) autoantibody ELISA kit

Sign In for Pricing
View Details
PFDN2 siRNA Oligos set (Human)
36426171 3x 5 nmol

PFDN2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
ATRX Rabbit Polyclonal Antibody
TA356679 100 µL

ATRX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DYNC2H1 Protein Lysate (Human) with C-Ha Tag
18757031 100 µg

DYNC2H1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details