Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF550 Rabbit Polyclonal Antibody (Biotin)

ZNF550 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q7Z398

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF550

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CTQCGKAFHRSTYLIQHSVIHTGEMPYKCIECGKAFKRRSHLLQHQRVHT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034743

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTND4P3 Protein Vector (Human) (pPM-C-HA)
PV102528 500 ng

MTND4P3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human B4GAT1 shRNA (UAS) - Lentiviral human B4GAT1 shRNA (UAS) (25)
GTR15315152 1 Vial

Lentiviral human B4GAT1 shRNA (UAS) - Lentiviral human B4GAT1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Low Affinity Nerve Growth Factor Receptor (LNGFR) ELISA Kit-Sandwich
EK5F883-01 48 Test

Mouse Low Affinity Nerve Growth Factor Receptor (LNGFR) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Low Affinity Nerve Growth Factor Receptor (LNGFR) ELISA Kit-Sandwich
EK5F883-02 96 Tests

Mouse Low Affinity Nerve Growth Factor Receptor (LNGFR) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Recombinant Human LPO
MBS7617558-01 0.05 mg

Recombinant Human LPO

Sign In for Pricing
View Details
Recombinant Human LPO
MBS7617558-02 0.2 mg

Recombinant Human LPO

Sign In for Pricing
View Details