Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF551 Rabbit Polyclonal Antibody (Biotin)

ZNF551 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q7Z340

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF551

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGYCHGMENEAIA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scara3 Mouse Pre-designed siRNA Set A
HY-RS21190 1 Set

Scara3 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
PPP2R5A (Serine/threonine-Protein Phosphatase 2A 56kD Regulatory Subunit alpha Isoform, PP2A B Subunit Isoform B'-alpha, PP2A B Subunit Isoform B56-alpha, PP2A B Subunit Isoform PR61-alpha, PR61alpha, PP2A B Subunit Isoform R5-alpha, PP2A-B56-alpha, PP2A-B56alpha, PP2A B56-alpha, PP2AB56alpha, PR61alpha, PP2A-B-PR61alpha)
225217-01 50 µL

PPP2R5A (Serine/threonine-Protein Phosphatase 2A 56kD Regulatory Subunit alpha Isoform, PP2A B Subunit Isoform B'-alpha, PP2A B Subunit Isoform B56-alpha, PP2A B Subunit Isoform PR61-alpha, PR61alpha, PP2A B Subunit Isoform R5-alpha, PP2A-B56-alpha, PP2A-B56alpha, PP2A B56-alpha, PP2AB56alpha, PR61alpha, PP2A-B-PR61alpha)

Sign In for Pricing
View Details
PPP2R5A (Serine/threonine-Protein Phosphatase 2A 56kD Regulatory Subunit alpha Isoform, PP2A B Subunit Isoform B'-alpha, PP2A B Subunit Isoform B56-alpha, PP2A B Subunit Isoform PR61-alpha, PR61alpha, PP2A B Subunit Isoform R5-alpha, PP2A-B56-alpha, PP2A-B56alpha, PP2A B56-alpha, PP2AB56alpha, PR61alpha, PP2A-B-PR61alpha)
225217-02 100 µL

PPP2R5A (Serine/threonine-Protein Phosphatase 2A 56kD Regulatory Subunit alpha Isoform, PP2A B Subunit Isoform B'-alpha, PP2A B Subunit Isoform B56-alpha, PP2A B Subunit Isoform PR61-alpha, PR61alpha, PP2A B Subunit Isoform R5-alpha, PP2A-B56-alpha, PP2A-B56alpha, PP2A B56-alpha, PP2AB56alpha, PR61alpha, PP2A-B-PR61alpha)

Sign In for Pricing
View Details
Rat Myosin-Binding Protein C, Slow-Type (MYBPC1) ELISA Kit
MBS9929771-01 48 Well

Rat Myosin-Binding Protein C, Slow-Type (MYBPC1) ELISA Kit

Sign In for Pricing
View Details
Rat Myosin-Binding Protein C, Slow-Type (MYBPC1) ELISA Kit
MBS9929771-02 96 Well

Rat Myosin-Binding Protein C, Slow-Type (MYBPC1) ELISA Kit

Sign In for Pricing
View Details
Rat Myosin-Binding Protein C, Slow-Type (MYBPC1) ELISA Kit
MBS9929771-03 5x 96 Well

Rat Myosin-Binding Protein C, Slow-Type (MYBPC1) ELISA Kit

Sign In for Pricing
View Details