Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF791 Rabbit Polyclonal Antibody (FITC)

ZNF791 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ90396, MGC126179, MGC126180

UniProt

Q3KP31

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF791

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ETFKNLASIGEKWEDPNVEDQHKNQGRNLRSHTGERLCEGKEGSQCAENF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_699189

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEP1 (Selenoprotein 1) Human ELISA Kit
G9581 96 Tests

SEP1 (Selenoprotein 1) Human ELISA Kit

Sign In for Pricing
View Details
Human HERPUD2 Pre-designed siRNA Set A
SI007019A 1 Each

Human HERPUD2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-MRP1/ABCC1 Antibody Picoband® (Dylight488 Conjugate)
A00872-1-Dylight488 100 µg

Anti-MRP1/ABCC1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Neurotrophin 3 Rabbit Polyclonal Antibody (BF488)
orb2559631 100 µL

Neurotrophin 3 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Goat Human IgG Fc, Affinity purified, Unconjugated, min, cross-reactivity to human IgA+IgM, affinity purified Antibody
orb700336 2 mg

Goat Human IgG Fc, Affinity purified, Unconjugated, min, cross-reactivity to human IgA+IgM, affinity purified Antibody

Sign In for Pricing
View Details
Keratin, Multi (BSA & Azide Free) (PE) discontinued
K0199-85X-PE 100 µL

Keratin, Multi (BSA & Azide Free) (PE) discontinued

Sign In for Pricing
View Details