Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF398 Rabbit Polyclonal Antibody (Biotin)

ZNF398 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P51, P71, ZER6

UniProt

Q8TD17

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF398

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_733787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK3 (Cyclin-dependent Kinase 3, Cell Division Protein Kinase 3, CDKN3) (HRP)
124781-HRP 100 µL

CDK3 (Cyclin-dependent Kinase 3, Cell Division Protein Kinase 3, CDKN3) (HRP)

Sign In for Pricing
View Details
Anti-C4A Rabbit Monoclonal Antibody
MA1544-.05 50 µL

Anti-C4A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FAM197Y3 3'UTR GFP Stable Cell Line
TU057679 1.0 mL

FAM197Y3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GNRH1 (Gonadotrophin Releasing Hormone 1, GRH, GNRH, HH12, LHRH, LNRH) (MaxLight 405)
MBS6418878-01 0.1 mL

GNRH1 (Gonadotrophin Releasing Hormone 1, GRH, GNRH, HH12, LHRH, LNRH) (MaxLight 405)

Sign In for Pricing
View Details
GNRH1 (Gonadotrophin Releasing Hormone 1, GRH, GNRH, HH12, LHRH, LNRH) (MaxLight 405)
MBS6418878-02 5x 0.1 mL

GNRH1 (Gonadotrophin Releasing Hormone 1, GRH, GNRH, HH12, LHRH, LNRH) (MaxLight 405)

Sign In for Pricing
View Details
mmu-miR-615-5p miRNA Inhibitor
MBS8295863-01 10 nmol

mmu-miR-615-5p miRNA Inhibitor

Sign In for Pricing
View Details