Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF596 Rabbit Polyclonal Antibody (HRP)

ZNF596 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8TC21

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF596

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_775810

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dusp9 Mouse Gene Knockout Kit (CRISPR)
KN304885BN 1 Kit

Dusp9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cardiac Troponin C Antibody
KC-2135-01 50 μL

Cardiac Troponin C Antibody

Sign In for Pricing
View Details
Cardiac Troponin C Antibody
KC-2135-02 100 µL

Cardiac Troponin C Antibody

Sign In for Pricing
View Details
Cardiac Troponin C Antibody
KC-2135-03 1 mL

Cardiac Troponin C Antibody

Sign In for Pricing
View Details
uLK2 (NM_014683) Human Over-expression Lysate
LC402363 20 µg

uLK2 (NM_014683) Human Over-expression Lysate

Sign In for Pricing
View Details
RPS13 Rabbit Polyclonal Antibody
TA381093 100 µL

RPS13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details