Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP660 Rabbit Polyclonal Antibody (Biotin)

ZFP660 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gm8008, EG623911, EG666257, Znf660 Gm8008

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVILHLRTHTKEKPYKCSECGRAYRYSSQLIQHQRKHNEEKGTLLFTSQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_001477566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAP31 Protein Vector (Mouse) (pPM-C-HA)
13203024 500 ng

BCAP31 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
HEATR7A CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23164154 3x 1.0 µg DNA

HEATR7A CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Anti-ABflo® 647 CD326/EPCAM (Rabbit, Monoclonal)
A108125 100 µL

Anti-ABflo® 647 CD326/EPCAM (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Rragc sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6746506 1.0 µg DNA

Rragc sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
TRNAE38P AAV Vector (Human) (CMV)
48005101 1 µg

TRNAE38P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
DNAJC7 Knockout K562 Polyclonal Cells
ARG39345 1 Million

DNAJC7 Knockout K562 Polyclonal Cells

Sign In for Pricing
View Details