Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF707 Rabbit Polyclonal Antibody (Biotin)

ZNF707 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96C28

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF707

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_776192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCP1A (DCP1 decapping Enzyme Homolog A (S. cerevisiae), FLJ21691, HSA275986, Nbla00360, SMAD4IP1, SMIF)
245218 100 µg

DCP1A (DCP1 decapping Enzyme Homolog A (S. cerevisiae), FLJ21691, HSA275986, Nbla00360, SMAD4IP1, SMIF)

Sign In for Pricing
View Details
YAP1   monoclonal antibody
MB11791 50ul

YAP1 monoclonal antibody

Sign In for Pricing
View Details
Nucleobindin 1 (NUCB1, CALNUC, NUC, FLJ40471) (MaxLight 550)
MBS6387718-01 0.1 mL

Nucleobindin 1 (NUCB1, CALNUC, NUC, FLJ40471) (MaxLight 550)

Sign In for Pricing
View Details
Nucleobindin 1 (NUCB1, CALNUC, NUC, FLJ40471) (MaxLight 550)
MBS6387718-02 5x 0.1 mL

Nucleobindin 1 (NUCB1, CALNUC, NUC, FLJ40471) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse Foxi2 shRNA (UAS) - Lentiviral mouse Foxi2 shRNA (UAS, GFP) plasmid
GTR15137122 1 Vial

Lentiviral mouse Foxi2 shRNA (UAS) - Lentiviral mouse Foxi2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Hsa-miR-3617-5p miRNA Inhibitor
CIH1107-01 10 nmol

Hsa-miR-3617-5p miRNA Inhibitor

Sign In for Pricing
View Details