Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAZF1 Rabbit Polyclonal Antibody (HRP)

JAZF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIP27, ZNF802

UniProt

Q86VZ6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human JAZF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_778231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TANK Protein
E30P939 20 µg

Recombinant Human TANK Protein

Sign In for Pricing
View Details
Sheep Tumor necrosis factor receptor superfamily member 10B ELISA kit
GTR10427655 96 Well

Sheep Tumor necrosis factor receptor superfamily member 10B ELISA kit

Sign In for Pricing
View Details
ATPAF1 Rabbit Polyclonal Antibody
orb326227 100 µL

ATPAF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Donkey Stanniocalcin 1 ELISA Kit
MBS049921 Inquire

Donkey Stanniocalcin 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Spindle assembly checkpoint component MAD1 (MAD1), partial
MBS1318694 Inquire

Recombinant Debaryomyces hansenii Spindle assembly checkpoint component MAD1 (MAD1), partial

Sign In for Pricing
View Details
DDX3 Polyclonal Antibody, Cy5 Conjugated
bs-12189R-Cy5 100 µL

DDX3 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details