Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLIG3 Rabbit Polyclonal Antibody (FITC)

OLIG3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Bhlhb7, bHLHe20

UniProt

Q7RTU3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OLIG3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_786923

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Zinc finger protein GLI1,GLI1 ELISA KIT
JOT-EK2448Ra-01 48 Well

Rat Zinc finger protein GLI1,GLI1 ELISA KIT

Sign In for Pricing
View Details
Rat Zinc finger protein GLI1,GLI1 ELISA KIT
JOT-EK2448Ra-02 96 Well

Rat Zinc finger protein GLI1,GLI1 ELISA KIT

Sign In for Pricing
View Details
SRC, phosphorylated (Tyr419) (Proto-oncogene Tyrosine-protein Kinase Src, p60-Src, c-Src, Proto-oncogene c-Src, pp60c-src, SRC1) (MaxLight 650) discontinued
S6500-10G-ML650 100 µL

SRC, phosphorylated (Tyr419) (Proto-oncogene Tyrosine-protein Kinase Src, p60-Src, c-Src, Proto-oncogene c-Src, pp60c-src, SRC1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
3100002H09Rik 3'UTR Luciferase Stable Cell Line
TU100571 1.0 mL

3100002H09Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SLC29A4 Rabbit Polyclonal Antibody (BF488)
orb1598414 100 µL

SLC29A4 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
HCFC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV791784 1.0 µg DNA

HCFC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details