Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF800 Rabbit Polyclonal Antibody (FITC)

ZNF800 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ43301, MGC130032, MGC130033

UniProt

Q2TB10

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF800

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MPLRDKYCQTDHHHHGCCEPVYILEPGDPPLLQQPLQTSKSGIQQIIECF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_789784

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-AMPKα1 (Ser485) Rabbit mAb
C05287-100uL*2 2x 100μL

Phospho-AMPKα1 (Ser485) Rabbit mAb

Sign In for Pricing
View Details
Celf4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3733903 1.0 µg DNA

Celf4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human procollagen type 3 , HPC3 ELISA Kit
MBS1606791-01 48 Well

Human procollagen type 3 , HPC3 ELISA Kit

Sign In for Pricing
View Details
Human procollagen type 3 , HPC3 ELISA Kit
MBS1606791-02 96 Well

Human procollagen type 3 , HPC3 ELISA Kit

Sign In for Pricing
View Details
Human procollagen type 3 , HPC3 ELISA Kit
MBS1606791-03 5x 96 Well

Human procollagen type 3 , HPC3 ELISA Kit

Sign In for Pricing
View Details
Human procollagen type 3 , HPC3 ELISA Kit
MBS1606791-04 10x 96 Well

Human procollagen type 3 , HPC3 ELISA Kit

Sign In for Pricing
View Details