Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2E Rabbit Polyclonal Antibody (Biotin)

TFAP2E Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AP2E, AP-2epsilon

UniProt

Q8IW12

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2E

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848643

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB13 Rabbit Polyclonal Antibody (Cy7)
orb1037104 100 µL

SERPINB13 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub1 (cdu1)
orb2925050-01 20 µg

Recombinant Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub1 (cdu1)

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub1 (cdu1)
orb2925050-02 100 µg

Recombinant Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub1 (cdu1)

Sign In for Pricing
View Details
KLF9 Recombinant Protein (Mouse)
RP145910 100 µg

KLF9 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Rhodopirellula baltica Adenylyl-sulfate kinase (cysC)
MBS1314867-01 0.02 mg (E-Coli)

Recombinant Rhodopirellula baltica Adenylyl-sulfate kinase (cysC)

Sign In for Pricing
View Details
Recombinant Rhodopirellula baltica Adenylyl-sulfate kinase (cysC)
MBS1314867-02 0.1 mg (E-Coli)

Recombinant Rhodopirellula baltica Adenylyl-sulfate kinase (cysC)

Sign In for Pricing
View Details