Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2E Rabbit Polyclonal Antibody (HRP)

TFAP2E Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP2E, AP-2epsilon

UniProt

Q8IW12

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2E

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848643

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRM Protein Vector (Mouse) (pPM-C-HA)
32174024 500 ng

NRM Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Nsun6 Pre-designed siRNA Set B
SI109629B 1 Each

Mouse Nsun6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Nori® Human VEGFR3/FLT4 ELISA Kit
GR111200 96 Well

Nori® Human VEGFR3/FLT4 ELISA Kit

Sign In for Pricing
View Details
PTP4A2 Antibody
CSB-PA137436-01 50 μL

PTP4A2 Antibody

Sign In for Pricing
View Details
PTP4A2 Antibody
CSB-PA137436-02 100 µL

PTP4A2 Antibody

Sign In for Pricing
View Details
Mmu-miR-210-5p miRNA Inhibitor
orb1870027-01 10 nmol

Mmu-miR-210-5p miRNA Inhibitor

Sign In for Pricing
View Details