Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF113B Rabbit Polyclonal Antibody (HRP)

RNF113B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF161, ZNF183L1, bA10G5.1

UniProt

Q8IZP6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RNF113B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_849192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC1, phosphorylated (S561) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 550) discontinued
043320-ML550 100 µL

TSC1, phosphorylated (S561) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 550) discontinued

Sign In for Pricing
View Details
FARSA Antibody - N-terminal region
OAAB04594-400UL 400 µL

FARSA Antibody - N-terminal region

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Transcription elongation factor GreA (greA)
MBS1050325-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Transcription elongation factor GreA (greA)
MBS1050325-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Transcription elongation factor GreA (greA)
MBS1050325-03 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Transcription elongation factor GreA (greA)
MBS1050325-04 0.1 mg (Yeast)

Recombinant Streptococcus pneumoniae Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details