Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HKR1 Rabbit Polyclonal Antibody (HRP)

HKR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HKR1

UniProt

P10072

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HKR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDVAVYFTQEEWRLLSPAQRTLHREVMLETYNHLVSLEIPSSKPKLIAQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_861451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC15A1, CT (Solute Carrier Family 15 Member 1, Intestinal H (+) /Peptide Cotransporter, Oligopeptide Transporter, Small Intestine Isoform, Peptide Transporter 1, PEPT1)
S5329-15A 50 µg

SLC15A1, CT (Solute Carrier Family 15 Member 1, Intestinal H (+) /Peptide Cotransporter, Oligopeptide Transporter, Small Intestine Isoform, Peptide Transporter 1, PEPT1)

Sign In for Pricing
View Details
LINGO3 Rabbit pAb, PE-Cy5.5 conjugated
orb2873030 100 µL

LINGO3 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
RB1 Antibody - C-terminal region : Biotin (ARP33212_P050-Biotin)
ARP33212_P050-Biotin 100 µL

RB1 Antibody - C-terminal region : Biotin (ARP33212_P050-Biotin)

Sign In for Pricing
View Details
HSPH1 Rabbit Polyclonal Antibody
E10G00437 100 µL

HSPH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C9orf30 (MSANTD3) Human shRNA Lentiviral Particle (Locus ID 91283)
TL305727V 500 µL Each

C9orf30 (MSANTD3) Human shRNA Lentiviral Particle (Locus ID 91283)

Sign In for Pricing
View Details
HA Tag Rabbit pAb
ATL1027-01 30 µL

HA Tag Rabbit pAb

Sign In for Pricing
View Details