Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF326 Rabbit Polyclonal Antibody (HRP)

ZNF326 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZIRD, ZAN75, Zfp326, dJ871E2.1

UniProt

Q5BKZ1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF326

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNIQGVGEGGEVGVVGEVEGVGEVEEVEELEEETAKEEPADFPVEQPEEN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_892021

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR3 AAV Vector (Human) (CMV)
22552101 1 µg

GPR3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant Bovine Platelet Factor-4/CXCL4
P1539-.1 100 µg

Recombinant Bovine Platelet Factor-4/CXCL4

Sign In for Pricing
View Details
Mouse Hexokinase, HK ELISA Kit
MBS1609557 96 Well

Mouse Hexokinase, HK ELISA Kit

Sign In for Pricing
View Details
MSK2 (Mitogen and Stress activated protein Kinase1) (MaxLight 650) discontinued
M4692-56-ML650 100 µL

MSK2 (Mitogen and Stress activated protein Kinase1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Cytoplasmic polyadenylation element binding protein 2 (CPEB2) ELISA Kit
GTR10349380 96 Well

Mouse Cytoplasmic polyadenylation element binding protein 2 (CPEB2) ELISA Kit

Sign In for Pricing
View Details
KLHL21 Polyclonal Antibody
bs-8048R 100 µL

KLHL21 Polyclonal Antibody

Sign In for Pricing
View Details