Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF497 Rabbit Polyclonal Antibody (Biotin)

ZNF497 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6ZNH5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF497

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_940860

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS26P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV784315 1.0 µg DNA

RPS26P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (MaxLight 750)
MBS6231998-01 0.1 mL

CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (MaxLight 750)

Sign In for Pricing
View Details
CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (MaxLight 750)
MBS6231998-02 5x 0.1 mL

CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Mettl7a2 qPCR Primer Pair
QM74074S 200 Tests

Mouse Mettl7a2 qPCR Primer Pair

Sign In for Pricing
View Details
AMPK alpha 2 Rabbit Polyclonal Antibody (BF680)
orb2449912 100 µL

AMPK alpha 2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Recombinant Human MIP-4 (CCL18)
BL10461_R-01 0.01 mg

Recombinant Human MIP-4 (CCL18)

Sign In for Pricing
View Details