Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM41 Rabbit Polyclonal Antibody (HRP)

TRIM41 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RINCK

UniProt

Q8WV44

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM41

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGVRLAERRQEVADHPKRFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_291027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RICK (RIP2, CARDIAK, RIP-like Interacting CLARP Kinase, Receptor Interacting Protein-2, CARD-containing ICE Associated Kinase) discontinued
R2031-58H 100 µg

RICK (RIP2, CARDIAK, RIP-like Interacting CLARP Kinase, Receptor Interacting Protein-2, CARD-containing ICE Associated Kinase) discontinued

Sign In for Pricing
View Details
A Cyclase VII Polyclonal Antibody
MBS8521015-01 0.1 mg

A Cyclase VII Polyclonal Antibody

Sign In for Pricing
View Details
A Cyclase VII Polyclonal Antibody
MBS8521015-02 0.1 mL (AF635)

A Cyclase VII Polyclonal Antibody

Sign In for Pricing
View Details
A Cyclase VII Polyclonal Antibody
MBS8521015-03 0.1 mL (AF610)

A Cyclase VII Polyclonal Antibody

Sign In for Pricing
View Details
A Cyclase VII Polyclonal Antibody
MBS8521015-04 0.1 mL (AF405S)

A Cyclase VII Polyclonal Antibody

Sign In for Pricing
View Details
A Cyclase VII Polyclonal Antibody
MBS8521015-05 0.1 mL (AF405L)

A Cyclase VII Polyclonal Antibody

Sign In for Pricing
View Details