Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU5F1 Rabbit Polyclonal Antibody (FITC)

POU5F1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OCT3, OCT4, OTF3, OTF4, OTF-3, Oct-3, Oct-4

UniProt

Q01860

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POU5F1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_976034

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Coiled coil domain containing protein 63 (CCDC63) ELISA Kit
MBS7241961-01 48 Well

Human Coiled coil domain containing protein 63 (CCDC63) ELISA Kit

Sign In for Pricing
View Details
Human Coiled coil domain containing protein 63 (CCDC63) ELISA Kit
MBS7241961-02 96 Well

Human Coiled coil domain containing protein 63 (CCDC63) ELISA Kit

Sign In for Pricing
View Details
Human Coiled coil domain containing protein 63 (CCDC63) ELISA Kit
MBS7241961-03 5x 96 Well

Human Coiled coil domain containing protein 63 (CCDC63) ELISA Kit

Sign In for Pricing
View Details
Human Coiled coil domain containing protein 63 (CCDC63) ELISA Kit
MBS7241961-04 10x 96 Well

Human Coiled coil domain containing protein 63 (CCDC63) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Breast carcinoma-amplified sequence 1 (BCAS1)
CSB-YP002596HU-01 20 µg

Recombinant Human Breast carcinoma-amplified sequence 1 (BCAS1)

Sign In for Pricing
View Details
Recombinant Human Breast carcinoma-amplified sequence 1 (BCAS1)
CSB-YP002596HU-02 100 µg

Recombinant Human Breast carcinoma-amplified sequence 1 (BCAS1)

Sign In for Pricing
View Details