Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFX4 Rabbit Polyclonal Antibody (HRP)

RFX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NYD-SP10

UniProt

Q33E94

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RFX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPATL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002911

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp2r1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7558107 1.0 µg DNA

Ppp2r1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
HES5 Antibody (Center)
E45R12366G-4 50 µL

HES5 Antibody (Center)

Sign In for Pricing
View Details
Phospho-MAP2 (Ser136) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-3259R-BF647 100 µL

Phospho-MAP2 (Ser136) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal TNF RI/TNFRSF1A Antibody (001) [mFluor Violet 450 SE]
NBP2-89687MFV450 0.1 mL

Rabbit Monoclonal TNF RI/TNFRSF1A Antibody (001) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
MAD1 Antibody
E51A07246 100 µL

MAD1 Antibody

Sign In for Pricing
View Details
CD45RA (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 405) discontinued
C2400-42-ML405 100 µL

CD45RA (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 405) discontinued

Sign In for Pricing
View Details