Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Znf667 Rabbit Polyclonal Antibody (HRP)

Znf667 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mip1, Znf667

UniProt

Q5MYW4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPAARGKSKSKAPVTFGDLAIYFSQEEWEWLSPNQKDLYEDVMLENYHNL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008557

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 Antibody Cocktail
V2243SAF-100UG 100 µg

CD45 Antibody Cocktail

Sign In for Pricing
View Details
Acetyl-α-Tubulin (Lys40) Rabbit mAb
C05305-100uL*2 2x 100μL

Acetyl-α-Tubulin (Lys40) Rabbit mAb

Sign In for Pricing
View Details
Cecropin B Rabbit pAb, Pacific Blue conjugated
orb2823347 100 µL

Cecropin B Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
VGLUT1 Recombinant Protein Antigen
NBP2-33597PEP 0.1 mL

VGLUT1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Human Receptor-type tyrosine-protein phosphatase T, PTPRT ELISA KIT
E1579Hu-01 48 Well

Human Receptor-type tyrosine-protein phosphatase T, PTPRT ELISA KIT

Sign In for Pricing
View Details
Human Receptor-type tyrosine-protein phosphatase T, PTPRT ELISA KIT
E1579Hu-02 96 Well

Human Receptor-type tyrosine-protein phosphatase T, PTPRT ELISA KIT

Sign In for Pricing
View Details