Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF527 Rabbit Polyclonal Antibody (FITC)

ZNF527 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF527

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GKAFHQILSLRLHQRIHAGEKPYKCNECGNNFSCVSALRRHQRIHNRETL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_030378

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human EGFR/ERBB1/HER1 (ABP 494)
DHB86924 100 μg

Research Grade Anti-Human EGFR/ERBB1/HER1 (ABP 494)

Sign In for Pricing
View Details
Rabbit Anti-Human INTS6 pAb
PA14994-01 50 μL

Rabbit Anti-Human INTS6 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human INTS6 pAb
PA14994-02 100 μL

Rabbit Anti-Human INTS6 pAb

Sign In for Pricing
View Details
Unc13a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
49174114 3x 1.0 µg

Unc13a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-HELZ2 Antibody
CTA4330-01 30 µL

Anti-HELZ2 Antibody

Sign In for Pricing
View Details
Anti-HELZ2 Antibody
CTA4330-02 50 μL

Anti-HELZ2 Antibody

Sign In for Pricing
View Details